l 2, 2025 Hunghank69 hot new sexy black belt cowboy lover monster cookie eater! 1 big dick cock 15 sec

15 secHunghank69 - 993 Views - 1 week ago -

Hot masturbation and tit fucking with cumshot 2 min

2 minMalte_Lili - 3.8k Views - 1 month ago -

Xoxo christina rides a big cock 88 sec

88 secXoxo_Christina - 4.7k Views - 2 months ago -

Xoxo christina fucked hard doggy by a big cock POV 2 min

2 minXoxo_Christina - 8.6k Views - 2 months ago -

Hunghank69 - update #29 - D1LVPointplateshimmyweirdfaceweirderface - Jul 29, 2025 19 sec

19 secHunghank69 - 495 Views - 1 week ago -

Hunghank69 - update #33 - Usaa - Aug 06, 202 Hunghank69 hot new sexy black belt cowboy lover monster cookie eater! 1 big dick cock 7 sec

7 secHunghank69 - 450 Views - 4 days ago -

Hunghank69, hunghank692bull, cooki3Monst3r69 - update #26 -Hunghank69 hot new sexy black belt cowboy Jul 10, 2025Hunghank69 hot new sexy black belt cowboy lover monster cookie eater! 1 big dick cock 21 sec

21 secHunghank69 - 226 Views - 1 month ago -

Hot masturbation and tit fucking with cumshot 2 min

2 minMalte_Lili - 4.9k Views - 1 month ago -

my bad 43 sec

43 secHunghank69 - 961 Views - 2 weeks ago -

Cum Daddy, 2025 Hunghank69 hot new sexy black belt cowboy lover monster cookie eater! 1 big dick cock 2 min

2 minHunghank69 - 2.2k Views - 1 week ago -

happy almost humpday 21 sec

21 secHunghank69 - 663 Views - 2 weeks ago -

Hunghank69 - update #24 - 1000006863 - Jul 04, 2025 Hunghank69 hot new sexy black belt cowboy lover monster cookie eater! 1 big dick cock 7 sec

7 secHunghank69 - 471 Views - 1 month ago -

Hunghank69 hot new sexy black belt cowboy lover monster cookie eater! 1 big dick cock 58 sec

58 secHunghank69 - 579 Views - 6 days ago -

Bbw spread and fucked 24 sec

24 secCamiCummings - 3k Views - 2 months ago -

Mallory Sucks Mickey !! 12 sec

12 secMallory_Knoxx - 648 Views - 2 weeks ago -

Monster Cock Invasion 22 sec

22 secMallory_Knoxx - 689 Views - 1 week ago -

Milf perfect blowjob 2 min

2 minMelinda955 - 2 months ago -

Wife riding hard 2 min

2 minMelinda955 - 2 months ago -

Gura Protein Feeding 31 sec

31 secRprhnksgwhif - 2 months ago -

Orihime bleach (theobrobine) 78 sec

78 secIfnennnmbqyh - 1 month ago -

Amateur Latina Wife Sloppy Deepthroat 36 sec

36 secChocolatecookies2330 - 2.5k Views - 3 weeks ago -

Pregnant Orihime Bleach (theobrobine) 78 sec

78 secIfnennnmbqyh - 1 week ago -

Latina BBW Wife Deepthroats a Amateur 13 sec

13 secChocolatecookies2330 - 2.7k Views - 3 weeks ago -

Cow Shenhe Genshin Impact (theobrobine) 2 min

2 minIfnennnmbqyh - 1 month ago -

Daddy long dicking princess 35 sec

35 secProfessormofo - 1.4k Views - 1 month ago -

Princess blindfolded Professor and told him to assume the position 44 sec

44 secProfessormofo - 2.4k Views - 2 months ago -

Vecino de Santurtzi se hace una paja gimiendo para que lo vean sus vecinas de Euskadi(Para mujeres) 36 sec

36 secJosusanturtzi - 420 Views - 4 days ago -